PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn251771
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 382aa    MW: 41867.3 Da    PI: 6.9784
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn251771genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.31.2e-31219274156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rF++a++qLGGs++AtPk+i+elm v+gLt+++vkSHLQkYRl+
  Achn251771 219 KARRCWSPELHRRFLHALQQLGGSHVATPKQIRELMMVDGLTNDEVKSHLQKYRLH 274
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-28216277IPR009057Homeodomain-like
PROSITE profilePS5129413.953216276IPR017930Myb domain
SuperFamilySSF466894.18E-18217277IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-26219274IPR006447Myb domain, plants
PfamPF002499.6E-7221272IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MINGYHNHNQ HNFTEKMQRC QEYIEALEKE RCKIQVFERE LPLCLDLVTQ AIESCRQQLS  60
GTTTTTEYFH GQSECSEQTS SEVPVLEQFI PIKRSSCSDD DEEQSEKPQN NNKDSKSNDK  120
SSKKSDWLKS VQLWNQTPDL PTKEDSPTNL PVIEVKKNGG GAFHPFKKEK NGGTIKTDPR  180
VLVPATAASS TTEIGGGDCG GSGDGDGKKE EKEGQSQRKA RRCWSPELHR RFLHALQQLG  240
GSHVATPKQI RELMMVDGLT NDEVKSHLQK YRLHTRRPTP STQNNNNPQQ PQFVVVGGIW  300
VPPPEYAAVA ASGEASGVAM TNGIYAPIAA PPPPPTQRQQ YNQSNQSHSG EMGSHSEGGG  360
GRCNSPATTS STHTSTASLA F*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003631224.11e-166PREDICTED: probable transcription factor GLK2
TrEMBLD7T9871e-164D7T987_VITVI; Putative uncharacterized protein
STRINGVIT_01s0011g03110.t011e-163(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.19e-83G2-like family protein